- Mitochondrial-processing peptidase subunit beta Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92120
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: WGFSESLLIR GAAGRSLYFG ENRLRSTQAA TQVVLNVPET RVTCLESGLR VASEDSGLST CTVGLWIDAG
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Beta-MPP, MAS1, MPP11, MPPB, MPPP52, P-52
- Mitochondrial-processing peptidase subunit beta
- peptidase, mitochondrial processing subunit beta
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Cancer, Cell Biology, Endocrinology, Immunology
Sequence
WGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVASEDSGLSTCTVGLWIDAG
Specifications/Features
Available conjugates: Unconjugated