CXCL12 Antibody PA1-29029 from Thermo Fisher Scientific

Product Specs
ItemCXCL12 Antibody
CompanyThermo Fisher Scientific
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberPA1-29029
NCBI Gene AliasesScyb12, Tpar1, Tlsf, Pbsf, Sdf1
Brand/TrademarkABR (now Thermo Scientific Pierce Antibodies)
Quantity100 µg
IsotypeIgG
FormatPBS with 0.1% sodium azide; pH 7.2
HostRabbit
ApplicationsImmunohistochemistry, Immunoprecipitation, Western Blot
Conjugate/TagUnconjugated
ReactivityMouse, Rat
ClonalityPolyclonal
TargetCXCL12
NCBI Full Gene NameC-X-C motif chemokine ligand 12, chemokine (C-X-C motif) ligand 12
Concentration1 mg/mL
ImmunogenRecombinant protein was generated using E coli-expressed mouse SDF-1alpha as an immunogen. The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
PurityProtein A
Antibody TypePrimary
StorageStore at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles

Add to Compare List

Thermo Fisher Scientific

81 Wyman Street

Waltham, MA 02451

United States

Phone: 800-678-5599
Fax: 800-331-2286

Company Profile

Website: www.thermofisher.com

(1) Mesenchymal stem cells inhibited the apoptosis of alveolar epithelial cells caused by ARDS through CXCL12/CXCR4 axisBioengineeredApril 4, 2022Xiqiang He, Chenyan Li, Hua Yin, Xiaojun Tan, Jun Yi, Shujun Tian, Yan Wang, Jian LiuTranswell (nest, 725,121), whereas 600 μL of F12K medium with or without 100 ng/mL CXCL12 (Thermo, PA129029) was added to the lower chamber at room temperature. After incubating for 48 hours, the colony formation

(2) A Pulmonary Vascular Model From Endothelialized Whole Organ ScaffoldsFrontiers in bioengineering and biotechnologyJanuary 1, 2021Yuan Y, Leiby KL, Greaney AM, Raredon MSB, Qian H, Schupp JC, Engler AJ, Baevova P, Adams TS, Kural MH, et al.conjugated-lectin GSII,Vectorlabs,FL1211 ZO1,ThermoFisher,617300 Connexin 40,Abcam,ab16585 Cxcl12,ThermoFisher,PA1-29029 Prx,Novus biologicals,NBP1-89598 Aplnr,Abcam,ab214369 Sirpa,LifeSpan Biosciences,LS-B551 Coup_TFII,Abcam,ab41859 Eln,Abcam,ab21610 Ednrb,Novus biologicals

(3) CCL2 and CXCL12 Derived from Mesenchymal Stromal Cells Cooperatively Polarize IL-10+ Tissue Macrophages to Mitigate Gut InjuryCell reportsFebruary 11, 2020Giri J, Das R, Nylen E, Chinnadurai R, Galipeau J.signaling Technologies,"Cat # 2029, RRID:AB_1264199" Rabbit anti CXCL12,Thermo Fisher Scientific,"Cat # PA1-29029, RRID:AB_2276940" Anti-Mouse CD 45.2 APC,BD PharMingen,"Cat # 558702, RRID:AB_1645215" Anti-Mouse

(4) Erythropoietin ameliorates renal interstitial fibrosis via the inhibition of fibrocyte accumulationMolecular medicine reportsMay 1, 2015Geng XC, Hu ZP, Lian GY.antibodies were purchased from Abcam (Cambridge, UK). Rabbit Polyclonal anti‑mouse CXCL12 (cat. no. PA1‑29029) was purchased from Thermo Fisher Scientific (Waltham, MA, USA). Goat Polyclonal anti‑mouse CC chemokine

Be the First to Write a Review!

WB

WB

CXCL12 Antibody

CXCL12 Antibody from Thermo Fisher Scientific

Thermo Fisher Scientific

Citations (4)

Reviews

CXCL12 Antibody from Thermo Fisher Scientific

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map