FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody TA331704 from OriGene Technologies | Biocompare.com

Supplier Images

FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody

Be the first to write a review!

Citations:

Supplier Page from
OriGene Technologies for
FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody

The FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to abhydrolase domain containing 17A, depalmitoylase, and ABHD17A. This antibody recognizes Human antigen. The FAM108A1 (ABHD17A) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ABHD17A Antibody

Product Specs
ItemFAM108A1 (ABHD17A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA331704
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetABHD17A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI
NCBI Full Gene Nameabhydrolase domain containing 17A, depalmitoylase
NCBI Gene AliasesFAM108A1, C19orf27
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!