PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody TA343090 from OriGene Technologies | Biocompare.com

Supplier Images

PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody

Be the first to write a review!

Citations:

Supplier Page from
OriGene Technologies for
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody

OriGene Technologies' PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody was generated using PIP5K1A as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-PIP5K1A Antibody

Product Specs
ItemPIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA343090
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetPIP5K1A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS
NCBI Full Gene Namephosphatidylinositol-4-phosphate 5-kinase type 1 alpha
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!