RPP30 Antibody - BSA Free NBP1-80658 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RPP30 Antibody

Immunocytochemistry/Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.
RPP30 Antibody

RPP30 Antibody
RPP30 Antibody

Immunocytochemistry/Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.
RPP30 Antibody

Immunocytochemistry/Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.
RPP30 Antibody

Immunocytochemistry/Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RPP30 Antibody - BSA Free

Product Specs
ItemRPP30 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-80658
HostRabbit
NCBI Gene AliasesTSG15
Conjugate/TagUnconjugated
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
ReactivityHuman
TargetRPP30
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: NVIISSAAER PLEIRGPYDV ANLGLLFGLS ESDAKAAVST NCRAALLHGE TRKTAFGIIS TVKKPRPSEG DEDCLPASKK AKCEG
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
NCBI Full Gene Nameribonuclease P/MRP subunit p30
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
Research AreaEndocrinology
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) BRAF(V600E) in colorectal cancer reduces sensitivity to oxidative stress and promotes site-specific metastasis by stimulating glutathione synthesisCell reportsJanuary 1, 0001"Laoukili J, van Schelven S, Küçükköse E, Verheem A, Goey K, Koopman M, Borel Rinkes I, Kranenburg O."

(2) NEIL3 contributes to the Fanconi anemia/BRCA pathway by promoting the downstream double-strand break repair stepCell reportsJanuary 1, 0001"Li N, Xu Y, Chen H, Chen L, Zhang Y, Yu T, Yao R, Chen J, Fu Q, Zhou J, et al."

Be the First to Write a Review!