- RPP30 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80658
- Rabbit
- TSG15
- Unconjugated
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- RPP30
- This antibody was developed against Recombinant Protein corresponding to amino acids: NVIISSAAER PLEIRGPYDV ANLGLLFGLS ESDAKAAVST NCRAALLHGE TRKTAFGIIS TVKKPRPSEG DEDCLPASKK AKCEG
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- ribonuclease P/MRP subunit p30
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Endocrinology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
Specifications/Features
Available conjugates: Unconjugated