- Plasminogen Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86015
- Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin
- Plasminogen
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: NKRWELCDIP RCTTPPPSSG PTYQCLKGTG ENYRGNVAVT VSGHTCQHWS AQTPHTHNRT PE
- Human
- plasminogen
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Angiogenesis, Cancer, Cell Cycle and Replication
- Primary Antibodies
- HAE4
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Specifications/Features
Available conjugates: Unconjugated