- GPM6B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81271
- This antibody was developed against Recombinant Protein corresponding to amino acids: AVPVFMFYNI WSTCEVIKSP QTNGTTGVEQ ICVDIRQYGI IPWNAFPGKI CGSALENICN TNEFYMSYH
- Unconjugated
- GPM6B
- Human
- M6B
- Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- glycoprotein M6B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Neuroscience
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Specifications/Features
Available conjugates: Unconjugated