- Prokineticin R2/PROKR2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92290
- This antibody was developed against Recombinant Protein corresponding to amino acids: AAQNGNTSFT PNFNPPQDHA SSLSFNFSYG DYDLPMDEDE DMTKTRTF
- GPR73L1, GPR73b, GPRg2, HH3, KAL3, PKR2, dJ680N4.3
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Prokineticin R2/PROKR2
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Human
- prokineticin receptor 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR, Protein Phosphatase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF
Specifications/Features
Available conjugates: Unconjugated