- S100B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87102
- Human, Mouse, Rat
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: LEKAMVALID VFHQYSGREG DKHKLKKSEL KELINNELSH FLEEIKEQEV VDKVMETLDN DGDGECDFQE FMAFVAMVTT ACHEFFEHE
- S100B
- PBS (pH 7.2) and 40% Glycerol
- NEF, S100, S100-B, S100beta
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- S100 calcium binding protein B
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Alzheimers Research, Apoptosis, Biologically Active Proteins, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Epigenetics, Hypoxia, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Peroxisome Markers, Signal Transduction, Stem Cells
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Specifications/Features
Available conjugates: Unconjugated