- PERP Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85173
- This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSDHGQTS SLWWKCSQEG GGSGSYEEGC QSLMEYAW
- Human
- EKVP7, KCP1, KRTCAP1, OLMS2, PIGPC1, THW, dJ496H19.1
- Unconjugated
- PERP
- Immunohistochemistry, Immunohistochemistry-Paraffin
- p53 apoptosis effector related to PMP22
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Immunogen affinity purified
- Apoptosis, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Tumor Suppressors
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Polyclonal
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
Sequence
LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Specifications/Features
Available conjugates: Unconjugated