- CBR1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86595
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- CBR1
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVT MKTNFFGTRD VCTELLPLIK PQGRVVNVSS IMSVRALKSC SPELQQKFRS ETITEEELVG LMNKFVE
- 0.1 ml (also 25ul)
- CBR, SDR21C1, PG-9-KR, hCBR1
- Unconjugated
- carbonyl reductase 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 30 kDa
- Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
Specifications/Features
Available conjugates: Unconjugated