- CD59 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89405
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 16.3A5, EJ30, G344, MIN3, p18-20, MIRL, HRF-20, EJ16, 1F5, MIC11, MACIF, MAC-IP, MSK21, MEM43, EL32, MIN1, MIN2, HRF20
- This antibody was developed against Recombinant Protein corresponding to amino acids: CYNCPNPTAD CKTAVNCSSD FDACLITKAG LQVYNKCWKF EHCNFNDVTT RLRENELTYY CCKKDLCNFN EQLENGG
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- 0.1 ml (also 25ul)
- CD59
- Rabbit
- CD59 molecule (CD59 blood group)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Biology, Cellular Markers, Immunology, Signal Transduction, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Specifications/Features
Available conjugates: Unconjugated