- UAF1/WDR48 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81404
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml
- Rabbit
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: SIIQCHILND KRHILTKDTN NNVAYWDVLK ACKVEDLGKV DFEDEIKKRF KMVYVPNWFS VDLKTGMLTI TLDESDCFAA WVSAKDAGF
- Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP)
- UAF1/WDR48
- SPG60, P80, Bun62, UAF1
- WD repeat domain 48
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 76 kDa
- Primary Antibodies
- Cell Biology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Specifications/Features
Available conjugates: Unconjugated