- BRP44L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91706
- 0.1 ml (also 25ul)
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAA DYVRSKDFRD YLMSTHFWGP VANWGLPIAA INDMKKSPEI ISGR
- BRP44L
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human, Mouse
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- BRP44L, CGI-129, MPYCD, SLC54A1
- mitochondrial pyruvate carrier 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Knockout Validated
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Specifications/Features
Available conjugates: Unconjugated