- MTF1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86379
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Immunogen affinity purified
- MTF1
- This antibody was developed against Recombinant Protein corresponding to amino acids: HLPFLVGGEE GFHLIDHEAM SQGYVQHIIS PDQIHLTINP GSTPMPRNIE GATLTLQSEC PETKRKEVK
- Rabbit
- IgG
- Primary Antibodies
- MTF-1, ZRF
- metal regulatory transcription factor 1
- Novus Biologicals, a Bio-Techne Brand
- Polyclonal
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Specifications/Features
Available conjugates: Unconjugated
Sequence
HLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVK