- SLC38A6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81010
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: KWSIPCPLTL NYVEKGFQIS NVTDDCKPKL FHFSKESA
- 0.1 ml (also 25ul)
- Unconjugated
- Human, Mouse
- SLC38A6
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- NAT-1, SNAT6
- solute carrier family 38 member 6
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
Specifications/Features
Available conjugates: Unconjugated