- TFF1/pS2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90813
- Unconjugated
- Human
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
- 0.1 ml (also 25ul)
- Rabbit
- TFF1/pS2
- This antibody was developed against Recombinant Protein corresponding to amino acids: QTETCTVAPR ERQNCGFPGV TPSQCANKGC CFDDTVRGVP WCFYPNTIDV PPE
- PBS (pH 7.2) and 40% Glycerol
- trefoil factor 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Breast Cancer, Cancer
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Specifications/Features
Available conjugates: Unconjugated