- Myosin Light Chain 2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85541
- Myosin Light Chain 2
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLT MFGEKLKGAD PEETILNAFK VFDPEGKGVL KADYVREMLT TQAERFSKEE VDQMFAAFPP DVTGNLDYKN LVHIITHGE
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
- Human, Mouse
- 0.1 ml (also 25ul)
- PBS (pH 7.2), 40% Glycerol
- CMH10, MFM12, MLC-2, MLC-2s/v, MLC-2v, MLC2
- myosin light chain 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Phospho Specific
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
Specifications/Features
Available conjugates: Unconjugated