- Methionine Sulfoxide Reductase A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87456
- Rabbit
- Unconjugated
- 0.1 ml
- This antibody was developed against Recombinant Protein corresponding to amino acids: ASNIVSPQEA LPGRKEQTPV AAKHHVNGNR TVEPFPEGTQ MAVFGMGCFW GAERKFWVLK GVYSTQVG
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PMSR
- Human
- Methionine Sulfoxide Reductase A
- PBS (pH 7.2) and 40% Glycerol
- methionine sulfoxide reductase A
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Specifications/Features
Available conjugates: Unconjugated