- HSD17B4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85296
- DBP, MFE-2, MFP-2, MPF-2, PRLTS1, SDR8C1
- Human, Mouse, Rat
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLF EVGAGWIGKL RWERTLGAIV RQKNHPMTPE AVKANWKKIC DFENASKPQS IQESTGSIIE VLSK
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- HSD17B4
- hydroxysteroid 17-beta dehydrogenase 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Specifications/Features
Available conjugates: Unconjugated