- Pit1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92273
- Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Human, Mouse
- This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKW LEEAEQVGAL YNEKVGANER KRKRRTTISI AAKDALERHF GEQNKPSSQE IMRMAE
- CPHD1, GHF-1, PIT1, POU1F1a, Pit-1
- Pit1
- Unconjugated
- POU class 1 homeobox 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Breast Cancer, Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
Specifications/Features
Available conjugates: Unconjugated