- Hornerin Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80807
- PBS (pH 7.2) and 40% Glycerol
- Human
- 0.1 ml (also 25ul)
- Rabbit
- FLG3, S100a18, S100A16
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: WSAGENDSYS RNVRGSLKPG TESISRRLSF QRDFSGQHNS YSGQSSSYGE QNSDSHQSSG RGQCGSGS
- Hornerin
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- hornerin
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Specifications/Features
Available conjugates: Unconjugated