- ARL3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88839
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: KLNVWDIGGQ RKIRPYWKNY FENTDILIYV IDSADRKRFE ETGQELAELL EEEKLSCVPV LI
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- ARL3
- Unconjugated
- 0.1 ml (also 25ul)
- RP83, JBTS35, ARFL3
- ADP ribosylation factor like GTPase 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 20 kDa
- Signal Transduction
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
Specifications/Features
Available conjugates: Unconjugated