- CTR2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85512
- This antibody was developed against Recombinant Protein corresponding to amino acids: YEGIKVGKAK LLNQVLVNLP TSISQQTIAE TDGDSAGSDS FPVGRTHHRW YLC
- COPT2, CTR2, hCTR2
- Human
- CTR2
- Rabbit
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- solute carrier family 31 member 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
Specifications/Features
Available conjugates: Unconjugated