- KLHL18 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-94016
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- KLHL18
- Human
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: EAKDYHLMPE RRPHLPAFRT RPRCCTSIAG LIYAVGGLNS AGDSLNVVEV FDPIANCWER CRPMTTARSR VGVAVVNGL
- kelch like family member 18
- IHC, IHC-p
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- 0.1 ml (also 25ul)
Sequence
EAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGL
Specifications/Features
Available conjugates: Unconjugated