- RPUSD4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82231
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- RPUSD4
- Unconjugated
- Human
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: NLVVINKPYG LPVHGGPGVQ LCITDVLPIL AKMLHGHKAE PLHLCHRLDK ETTGVMVLAW DKDMAHQVQE LFRTRQVVKK YWAITVHVP
- RNA pseudouridine synthase D4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVP
Specifications/Features
Available conjugates: Unconjugated