- HPSC152 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92009
- PBS (pH 7.2) and 40% Glycerol
- HSPC152, HSPC170, TRM112, TRMT11-2, hTrm112
- Human
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: LIQVPKGPVE GYEENEEFLR TMHHLLLEVE VIEGTLQCPE SGRMFPISRG IPNMLLSEEE TES
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin
- HPSC152
- Unconjugated
- tRNA methyltransferase activator subunit 11-2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Specifications/Features
Available conjugates: Unconjugated