- Regucalcin Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80849
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- GNL, HEL-S-41, RC, SMP30
- 0.1 ml (also 25ul)
- Human, Mouse, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVAC YNGGRVIRLD PVTGKRLQTV KLPVDKTTSC CFGGKNYSEM YVTCARDGMD PEGLLRQPEA GGIFKITGLG VKGIAPYSY
- Regucalcin
- Unconjugated
- Rabbit
- regucalcin
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY
Specifications/Features
Available conjugates: Unconjugated