- Tensin 1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84129
- 0.1 ml (also 25ul)
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human, Mouse, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: EEPLNLEGLV AHRVAGVQAR EKQPAEPPAP LRRRAASDGQ YENQSPEATS PRSPGVRSPV QCVSPELALT IALNPGGRPK EPHLHSYK
- Unconjugated
- MST091, MST122, MST127, MSTP091, MSTP122, MSTP127, MXRA6, PPP1R155, TNS
- Tensin 1
- PBS (pH 7.2) and 40% Glycerol
- tensin 1
- IgG
- Novus Biologicals, a Bio-Techne Brand
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication, Signal Transduction
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
Specifications/Features
Available conjugates: Unconjugated