- NAT11 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92168
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: DLTKTNMQTM YEQSEWGWKD REKREEMTDD RAWYLIAWEN SSVPVAFSHF RFDVECGDEV LYCYEVQLES KV
- Unconjugated
- NAT11, NatD, PATT1, hNatD
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- N-alpha-acetyltransferase 40, NatD catalytic subunit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Apoptosis, Cancer, Cell Biology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- NAT11
Sequence
DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
Specifications/Features
Available conjugates: Unconjugated