- CAPRIN2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88318
- C1QDC1, EEG-1, EEG1, RNG140
- Rabbit
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: TPKPRENNVE SQKHSLTSQS QISPKSWGVA TASLIPNDQL LPRKLNTEPK DVPKPVHQPV GSSSTLPKDP VLRKEKLQDL MTQIQGT
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- CAPRIN2
- caprin family member 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology, Cell Cycle and Replication, Stem Cells
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TPKPRENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT
Specifications/Features
Available conjugates: Unconjugated