- HspA1L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92012
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human, Mouse, Rat
- This antibody was developed against Recombinant Protein corresponding to amino acids: KLYQGGCTGP ACGTGYVPGR PATGPTIEEV D
- 0.1 ml (also 25ul)
- HspA1L
- HSP70-1L, HSP70-HOM, HSP70T, hum70t
- heat shock protein family A (Hsp70) member 1 like
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cancer
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Specifications/Features
Available conjugates: Unconjugated