- Eva-1 Homolog C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88937
- Eva-1 Homolog C
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: PSESDFPGEL SGFCRTSYPI YSSIEAAELA ERIERREQII QEIWMNSGLD TSLPRNMGQF Y
- B18, B19, C21orf63, C21orf64, FAM176C, PRED34, SUE21
- Human
- Rabbit
- Unconjugated
- eva-1 homolog C
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
Specifications/Features
Available conjugates: Unconjugated