- gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86728
- 0.1 ml (also 25ul)
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: QEGVKSGMYV VIEVKVATQE GKEITCRSYL MTNYESAPPS PQYKKIICMG AKENGLPLEY QEKLKAIEPN DYTGKVSEEI E
- gamma-Glutamylcyclotransferase/CRF21/GGCT
- PBS (pH 7.2) and 40% Glycerol
- C7orf24, CRF21, GCTG, GGC
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Rabbit
- Unconjugated
- gamma-glutamylcyclotransferase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Apoptosis, Cell Biology, Endocrinology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE
Specifications/Features
Available conjugates: Unconjugated