- MRPL51 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88567
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: GNFEKHPKEL IRGPIWLRGW KGNELQRCIR KRKMVGSRMF ADDLHNLNKR IRYLYKHFNR
- PBS (pH 7.2) and 40% Glycerol
- Human
- Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- MRPL51
- CDA09, HSPC241, MRP64, bMRP64
- mitochondrial ribosomal protein L51
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Specifications/Features
Available conjugates: Unconjugated