- TSGA2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89839
- Rabbit
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human, Mouse
- TSGA2
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: TAELIHLNHR YQGKFLNKNP VGPGKYVFDV GCEQHGEYRL TDMERGEEEE EEELVTVVPK WKATQITELA LWTPTL
- CT79, RSP44, RSPH10A, TSA2, TSGA2
- radial spoke head component 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
Specifications/Features
Available conjugates: Unconjugated