- FAM107B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88535
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- FAM107B
- Western Blot, Immunocytochemistry/ Immunofluorescence
- family with sequence similarity 107 member B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- This antibody was developed against Recombinant Protein corresponding to amino acids: FHASIPRPSI IDTPKEEEFR EEPKCLELEQ KMTSDSPPED IDHKDSYLIT RSIMAEPDYI EDDNPELIRP QKLINPVK
- Rabbit
- 0.1 ml (also 25ul)
- C10orf45, HITS
Sequence
FHASIPRPSIIDTPKEEEFREEPKCLELEQKMTSDSPPEDIDHKDSYLITRSIMAEPDYIEDDNPELIRPQKLINPVK
Specifications/Features
Available conjugates: Unconjugated