- SLC25A39 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84502
- SLC25A39
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: RLQSQRPSMA SELMPSSRLW SLSYTKWKCL LYCNGVLEPL YLCPNGARCA TWFQDPTRFT GTMDAFVKIV RHEGTRTL
- CGI-69, CGI69
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- Rabbit
- solute carrier family 25 member 39
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cancer, Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTL
Specifications/Features
Available conjugates: Unconjugated