- TOMM22 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80671
- 0.1 ml (also 25ul)
- MSTP065, MST065, 1C9-2, TOM22
- TOMM22
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Human, Mouse
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGA GEPQSPDELL PKGDAEKPEE ELEEDDDEEL DETLSERLWG LTEMFPERVR SAAGATFDLS LFVAQK
- translocase of outer mitochondrial membrane 22
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Membrane Trafficking and Chaperones
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Specifications/Features
Available conjugates: Unconjugated