- C8orf76 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82221
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: PHSGKDCLLC FPETLPESSL FSVEANSSNS QKNEKALTNI QNCMAEKRET VLIETQLKAC ASFIRTRLLL QFTQPQQ
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- C8orf76
- PBS (pH 7.2) and 40% Glycerol
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- chromosome 8 open reading frame 76
Sequence
PHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQ
Specifications/Features
Available conjugates: Unconjugated