- SLC2A13 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83245
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- SLC2A13
- Rabbit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Alzheimers Research, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- solute carrier family 2 member 13
- HMIT
- This antibody was developed against Recombinant Protein corresponding to amino acids: ITFKPIAPSG QNATCTRYSY CNECMLDPDC GFCYKMNKST VIDSSCVPVN KASTNEAAWG RCENETKFKT EDI
- PBS (pH 7.2) and 40% Glycerol
Sequence
ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDI
Specifications/Features
Available conjugates: Unconjugated