- SEC11C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80774
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- SEC11L3, SPC21, SPCS4C
- This antibody was developed against Recombinant Protein corresponding to amino acids: MVRAGAVGAH LPASGLDIFG DLKKMNKRQL YYQV
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- SEC11C
- Rabbit
- Human
- Unconjugated
- SEC11 homolog C, signal peptidase complex subunit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Specifications/Features
Available conjugates: Unconjugated