- SLC15A4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87279
- Rabbit
- Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- SLC15A4
- This antibody was developed against Recombinant Protein corresponding to amino acids: TKPPDGSAFT DMFKILTYSC CSQKRSGERQ SNGEGIGVFQ QSSKQSLFDS CKMSHGGPFT EEKVEDVK
- Human, Mouse
- solute carrier family 15 member 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- FP12591, PHT1, PTR4
Sequence
TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Specifications/Features
Available conjugates: Unconjugated