- AGPAT9 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93692
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- Rabbit
- AGPAT9
- HMFN0839, AGPAT10, MAG1, AGPAT 10, LPAAT-theta, AGPAT9, AGPAT8
- 0.1 ml (also 25ul)
- Unconjugated
- glycerol-3-phosphate acyltransferase 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- 49 kDa
- Immunogen affinity purified
- This antibody was developed against Recombinant Protein corresponding to amino acids: ILVKTLEWAT IRIEKGTPKE SILKNSASVG IIQRDESPME KGLSGLRGRD FELSDVFYFS KKGLEAIVED EVTQRFSSEE LVSWNLLTRT N
- PBS (pH 7.2) and 40% Glycerol
Sequence
ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN
Specifications/Features
Available conjugates: Unconjugated