- DEFA6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84281
- Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml
- DEFA6
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQ AKAYEADAQE QRGANDQDFA VSFAEDASSS LRALGSTRAF TCHCRRSCYS TEYSYGTCTV MGINHRFC
- Human
- DEF6, HD-6
- defensin alpha 6
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
Specifications/Features
Available conjugates: Unconjugated