- LIN9 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80690
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: LNKDLNKVLH KVQQYCYELA PDQGLQPADQ PTDMRRRCEE EAQEIVRHAN SSTGQPCVEN ENLTDLISRL TAILLQIKCL A
- LIN9
- BARA, BARPsv, Lin-9, TGS, TGS1, TGS2
- lin-9 DREAM MuvB core complex component
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Cell Biology, Cell Cycle and Replication
Sequence
LNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA
Specifications/Features
Available conjugates: Unconjugated