- FGFR2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88670
- 0.1 ml (also 25ul)
- IgG
- Unconjugated
- Human, Mouse
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- FGFR2
- This antibody was developed against Recombinant Protein corresponding to amino acids: PPTKYQISQP EVYVAAPGES LEVRCLLKDA AVISWTKDGV HLGPNNRTVL IGEYLQIKGA TPRDSGLYAC TASRTVDSET WYFMV
- BEK, K-SAM, BFR-1, KGFR, JWS, TK14, CFD1, BBDS, TK25, CD332, CEK3, ECT1
- Rabbit
- fibroblast growth factor receptor 2
- Novus Biologicals, a Bio-Techne Brand
- Polyclonal
- Immunogen affinity purified
- Angiogenesis, Protein Kinase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
Specifications/Features
Available conjugates: Unconjugated