- AP-2 beta/TFAP2B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89063
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: QRQRQEVGSE AGSLLPQPRA ALPQLSGLDP RRDYHSVRRP DVLLHSAHHG LDAGMG
- Human, Mouse
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- AP-2 beta/TFAP2B
- AP-2B, AP-2beta, AP2-B, PDA2
- transcription factor AP-2 beta
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Neuroscience
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
Specifications/Features
Available conjugates: Unconjugated