SOX11 Antibody NBP1-85823 from Novus Biologicals, a Bio-Techne Brand

Product Specs
ItemSOX11 Antibody
CompanyNovus Biologicals, a Bio-Techne Brand
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberNBP1-85823
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
HostRabbit
Conjugate/TagUnconjugated
ReactivityHuman
ApplicationsWestern Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: FMVWSKIERR KIMEQSPDMH NAEISKRLGK RWKMLKDSEK IPFIREAERL RLKHMADYPD YKYRPRKKPK MDPSAKPSAS QSPEKSAAGG GGGSAGGGAG GAKTSKGSSK K
TargetSOX11
Brand/TrademarkNovus Biologicals, a Bio-Techne Brand
IsotypeIgG
ClonalityPolyclonal
PurityImmunogen affinity purified
NCBI Full Gene NameSRY-box transcription factor 11
NCBI Gene AliasesCSS9, IDDMOH, MRD27
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: http://www.novusbio.com

(1) Reproducibility of SOX-11 detection in decalcified bone marrow tissue in mantle cell lymphoma patientsHuman pathologyJanuary 1, 2017Righi S, Pileri S, Agostinelli C, Bacci F, Spagnolo S, Sabattini E.

(2) Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtypeModern pathology : an official journal of the United States and Canadian Academy of Pathology, IncNovember 1, 2015Ribera-Cortada I, Martinez D, Amador V, Royo C, Navarro A, Beà S, Gine E, de Leval L, Serrano S, Wotherspoon A, et al.

(3) High-resolution chromatin immunoprecipitation (ChIP) sequencing reveals novel binding targets and prognostic role for SOX11 in mantle cell lymphomaOncogeneMarch 5, 2015Kuo PY, Leshchenko VV, Fazzari MJ, Perumal D, Gellen T, He T, Iqbal J, Baumgartner-Wennerholm S, Nygren L, Zhang F, et al.

(4) The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusionsHuman pathologyJanuary 1, 2015Davidson B, Holth A, Hellesylt E, Tan TZ, Huang RY, Tropé C, Nesland JM, Thiery JP.

(5) The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseasesMedical oncology (Northwood, London, England)June 1, 2012Cao X, Fan L, Fang C, Zhu DX, Dong HJ, Wang DM, Wang YH, Xu W, Li JY.

(6) Prognostic role of SOX11 in a population-based cohort of mantle cell lymphomaBloodMay 3, 2012Nygren L, Baumgartner Wennerholm S, Klimkowska M, Christensson B, Kimby E, Sander B.

(7) In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behaviorHaematologicaFebruary 1, 2012Carvajal-Cuenca A, Sua LF, Silva NM, Pittaluga S, Royo C, Song JY, Sargent RL, Espinet B, Climent F, Jacobs SA, et al.

(8) The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylationBMC cancerSeptember 24, 2011Sernbo S, Gustavsson E, Brennan DJ, Gallagher WM, Rexhepaj E, Rydnert F, Jirström K, Borrebaeck CA, Ek S.

(9) Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 indexCancer scienceSeptember 1, 2011Kimura Y, Sato K, Imamura Y, Arakawa F, Kiyasu J, Takeuchi M, Miyoshi H, Yoshida M, Niino D, Sugita Y, et al.

(10) Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosisHaematologicaAugust 1, 2011Ondrejka SL, Lai R, Smith SD, Hsi ED.

(11) Gene expression profiling and chromatin immunoprecipitation identify DBN1, SETMAR and HIG2 as direct targets of SOX11 in mantle cell lymphomaPloS oneNovember 22, 2010Wang X, Björklund S, Wasik AM, Grandien A, Andersson P, Kimby E, Dahlman-Wright K, Zhao C, Christensson B, Sander B.

(12) SOX11 expression correlates to promoter methylation and regulates tumor growth in hematopoietic malignanciesMolecular cancerJuly 12, 2010Gustavsson E, Sernbo S, Andersson E, Brennan DJ, Dictor M, Jerkeman M, Borrebaeck CA, Ek S.

(13) Wilms tumor chromatin profiles highlight stem cell properties and a renal developmental networkCell stem cellJune 4, 2010Aiden AP, Rivera MN, Rheinbay E, Ku M, Coffman EJ, Truong TT, Vargas SO, Lander ES, Haber DA, Bernstein BE.

(14) Genomic and gene expression profiling defines indolent forms of mantle cell lymphomaCancer researchFebruary 15, 2010Fernàndez V, Salamero O, Espinet B, Solé F, Royo C, Navarro A, Camacho F, Beà S, Hartmann E, Amador V, et al.

(15) Nuclear expression of sox11 is highly associated with mantle cell lymphoma but is independent of t(11;14)(q13;q32) in non-mantle cell B-cell neoplasmsModern pathology : an official journal of the United States and Canadian Academy of Pathology, IncJanuary 1, 2010Chen YH, Gao J, Fan G, Peterson LC.

(16) Strong lymphoid nuclear expression of SOX11 transcription factor defines lymphoblastic neoplasms, mantle cell lymphoma and Burkitt's lymphomaHaematologicaNovember 1, 2009Dictor M, Ek S, Sundberg M, Warenholt J, György C, Sernbo S, Gustavsson E, Abu-Alsoud W, Wadström T, Borrebaeck C.

(17) SOX11 expression is highly specific for mantle cell lymphoma and identifies the cyclin D1-negative subtypeHaematologicaNovember 1, 2009Mozos A, Royo C, Hartmann E, De Jong D, Baró C, Valera A, Fu K, Weisenburger DD, Delabie J, Chuang SS, et al.

(18) The subcellular Sox11 distribution pattern identifies subsets of mantle cell lymphoma: correlation to overall survivalBritish journal of haematologyOctober 1, 2008Wang X, Asplund AC, Porwit A, Flygare J, Smith CI, Christensson B, Sander B.

(19) Nuclear expression of the non B-cell lineage Sox11 transcription factor identifies mantle cell lymphomaBloodJanuary 15, 2008Ek S, Dictor M, Jerkeman M, Jirström K, Borrebaeck CA.

(20) From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignanciesMolecular & cellular proteomics : MCPJune 1, 2006Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA.

Write a Review

(1)

8/11/2020Western Blot Analysis of Glioma Cell Lysate With sox11 Antibody Raghavendra VadlaOur aim is to analyse the levels of SOX11 in glioma cell lysates by western blot. Briefly, cells were lysed in ripa buffer, centrifuged and supernatant was collected. Loaded 30ug of protein on SDS-... Read Review

SOX11 Antibody

SOX11 Antibody

SOX11 Antibody

SOX11 Antibody

SOX11 Antibody from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (20)

Reviews

SOX11 Antibody from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map