- LRPPRC Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83349
- Human
- LRPPRC
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- Unconjugated
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: RIWDTLQKLG AVYDVSHYNA LLKVYLQNEY KFSPTDFLAK MEEANIQPNR VTYQRLIASY CNVGDIEGAS KILGFMKTKD LPVT
- CLONE-23970, GP130, LRP130, LSFC, MC4DN5
- leucine rich pentatricopeptide repeat containing
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Endocrinology, Neurodegeneration, Neuroscience
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Specifications/Features
Available conjugates: Unconjugated